PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054315
Common NameLOC102578532
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 252aa    MW: 27502 Da    PI: 8.0841
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054315genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.11.5e-32177235159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  PGSC0003DMP400054315 177 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHS 235
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.4E-34162235IPR003657WRKY domain
SuperFamilySSF1182901.19E-28169235IPR003657WRKY domain
PROSITE profilePS5081129.608172234IPR003657WRKY domain
SMARTSM007746.5E-38177236IPR003657WRKY domain
PfamPF031063.1E-25178234IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MERGSEERNQ LNNYNLQVSF SSSSSAAAPN HVHHELGFIH FADQNLSFLA PSSQSSQSLQ  60
AAAAAAAAAA SVSVTPSAAI NTNAAAAGAS NNVGGGGGGL GFSHNELLVN RPSWNNNEQV  120
ETLDPKGIND ENCSGNASEG NNSWWKSSSS DKGKVKIRRK LREPRFCFQT RSDIDVLDDG  180
YKWRKYGQKV VKNSLHPRSY YRCTHSNCRV KKRVERLSED CRMVITTYEG RHNHSPCDDS  240
NSSDHDCFTS F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-26168234874Probable WRKY transcription factor 4
2lex_A1e-26168234874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155161KIRRKLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755131e-85HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347986.10.0PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY42e-73WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLM1D2Y00.0M1D2Y0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000800690.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA73362029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.18e-64WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]